IGSF9 Antikörper (N-Term)
-
- Target Alle IGSF9 Antikörper anzeigen
- IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGSF9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IGSF9 antibody was raised against the N terminal of IGSF9
- Aufreinigung
- Affinity purified
- Immunogen
- IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
- Top Product
- Discover our top product IGSF9 Primärantikörper
-
anti-Immunoglobulin Superfamily, Member 9 (IGSF9) antibody
IGSF9 Reaktivität: Human, Maus, Ratte ELISA, WB, IF (p), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Immunoglobulin Superfamily, Member 9 (IGSF9) (AA 132-298) antibodyIGSF9 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Immunoglobulin Superfamily, Member 9 (IGSF9) (AA 74-123) antibodyIGSF9 Reaktivität: Human, Rind (Kuh), Hund, Pferd, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Immunoglobulin Superfamily, Member 9 (IGSF9) (N-Term) antibodyIGSF9 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGSF9 Blocking Peptide, catalog no. 33R-8693, is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))
- Andere Bezeichnung
- IGSF9 (IGSF9 Produkte)
- Synonyme
- FP18798 antikoerper, IGSF9A antikoerper, Nrt1 antikoerper, 644ETD8 antikoerper, Dasm1 antikoerper, Kiaa1355-hp antikoerper, NRT1 antikoerper, Ncaml antikoerper, mKIAA1355 antikoerper, immunoglobulin superfamily member 9 antikoerper, immunoglobulin superfamily, member 9 antikoerper, IGSF9 antikoerper, igsf9 antikoerper, Igsf9 antikoerper
- Hintergrund
- IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
- Molekulargewicht
- 125 kDa (MW of target protein)
-
