TMEM48 Antikörper (Middle Region)

Produktnummer ABIN635787

Produktdetails anti-TMEM48 Antikörper

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM48 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM48 antibody was raised against the middle region of TMEM48

Aufreinigung: Affinity purified

Immunogen: TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM48 Blocking Peptide, catalog no. 33R-8441, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM48

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Andere Bezeichnung: TMEM48 (TMEM48 Produkte)

Synonyme: 2810475A17Rik antikoerper, AI450313 antikoerper, Tmem48 antikoerper, NET3 antikoerper, TMEM48 antikoerper, tmem48 antikoerper, wu:fk93f04 antikoerper, zgc:55636 antikoerper, Xndr antikoerper, NDC1 transmembrane nucleoporin antikoerper, NDC1 transmembrane nucleoporin S homeolog antikoerper, Xrcc1 N-terminal domain containing 1 antikoerper, Ndc1 antikoerper, NDC1 antikoerper, ndc1 antikoerper, ndc1.S antikoerper, Xndc1 antikoerper

Hintergrund: TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

Molekulargewicht: 76 kDa (MW of target protein)