TMEM48 Antikörper (Middle Region)
-
- Target Alle TMEM48 Antikörper anzeigen
- TMEM48 (Transmembrane Protein 48 (TMEM48))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM48 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM48 antibody was raised against the middle region of TMEM48
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL
- Top Product
- Discover our top product TMEM48 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM48 Blocking Peptide, catalog no. 33R-7260, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM48 (Transmembrane Protein 48 (TMEM48))
- Andere Bezeichnung
- TMEM48 (TMEM48 Produkte)
- Synonyme
- 2810475A17Rik antikoerper, AI450313 antikoerper, Tmem48 antikoerper, NET3 antikoerper, TMEM48 antikoerper, tmem48 antikoerper, wu:fk93f04 antikoerper, zgc:55636 antikoerper, Xndr antikoerper, NDC1 transmembrane nucleoporin antikoerper, NDC1 transmembrane nucleoporin S homeolog antikoerper, Xrcc1 N-terminal domain containing 1 antikoerper, Ndc1 antikoerper, NDC1 antikoerper, ndc1 antikoerper, ndc1.S antikoerper, Xndc1 antikoerper
- Hintergrund
- TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.
- Molekulargewicht
- 76 kDa (MW of target protein)
-