ADAM19 Antikörper
-
- Target Alle ADAM19 (Adam19) Antikörper anzeigen
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
- Top Product
- Discover our top product Adam19 Primärantikörper
-
anti-ADAM Metallopeptidase Domain 19 (Adam19) (N-Term) antibody
Adam19 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 207-236) antibodyAdam19 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB17773 unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 203-460) antibodyAdam19 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (Internal Region) antibodyVerified Adam19 Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 286-298), (N-Term) antibodyAdam19 Reaktivität: Human, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 215-245), (Middle Region) antibodyAdam19 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 251-350) antibodyAdam19 Reaktivität: Human WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (C-Term) antibodyAdam19 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 203-460) antibodyAdam19 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ADAM Metallopeptidase Domain 19 (Adam19) (AA 217-266) antibodyAdam19 Reaktivität: Human, Maus, Kaninchen, Hund, Rind (Kuh), Meerschweinchen, Pferd, Affe, Schwein, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAM19 Blocking Peptide, catalog no. 33R-3525, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
- Andere Bezeichnung
- ADAM19 (Adam19 Produkte)
- Synonyme
- AL024287 antikoerper, M[b] antikoerper, Mltnb antikoerper, MADDAM antikoerper, MLTNB antikoerper, Sox30 antikoerper, fksg34 antikoerper, maddam antikoerper, mltnb antikoerper, a disintegrin and metallopeptidase domain 19 (meltrin beta) antikoerper, ADAM metallopeptidase domain 19 antikoerper, ADAM metallopeptidase domain 19 S homeolog antikoerper, Adam19 antikoerper, ADAM19 antikoerper, adam19.S antikoerper
- Hintergrund
- ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation.
- Molekulargewicht
- 82 kDa (MW of target protein)
-
