SLAMF6 Antikörper (N-Term)

Produktnummer ABIN635797

Produktdetails anti-SLAMF6 Antikörper

Target: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLAMF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLAMF6 antibody was raised against the N terminal of SLAMF6

Aufreinigung: Affinity purified

Immunogen: SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLAMF6 Blocking Peptide, catalog no. 33R-6685, is also available for use as a blocking control in assays to test for specificity of this SLAMF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAMF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLAMF6

Target: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Andere Bezeichnung: SLAMF6 (SLAMF6 Produkte)

Synonyme: SLAMF6 antikoerper, CD352 antikoerper, KALI antikoerper, KALIb antikoerper, Ly108 antikoerper, NTB-A antikoerper, NTBA antikoerper, SF2000 antikoerper, KAL1 antikoerper, KAL1b antikoerper, RGD1561848 antikoerper, SLAM family member 6 antikoerper, SLAMF6 antikoerper, Slamf6 antikoerper

Hintergrund: SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Molekulargewicht: 34 kDa (MW of target protein)