FZD10 Antikörper
-
- Target Alle FZD10 Antikörper anzeigen
- FZD10 (Frizzled Family Receptor 10 (FZD10))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FZD10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
- Top Product
- Discover our top product FZD10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FZD10 Blocking Peptide, catalog no. 33R-7152, is also available for use as a blocking control in assays to test for specificity of this FZD10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FZD10 (Frizzled Family Receptor 10 (FZD10))
- Andere Bezeichnung
- FZD10 (FZD10 Produkte)
- Synonyme
- CD350 antikoerper, FZ-10 antikoerper, Fz10 antikoerper, FzE7 antikoerper, hFz10 antikoerper, cFz-10 antikoerper, Fz-10 antikoerper, Xfr9 antikoerper, Xfz10 antikoerper, frizzled-10 antikoerper, frizzled10 antikoerper, fz10 antikoerper, fze7 antikoerper, hfz10 antikoerper, fk48e04 antikoerper, fz4 antikoerper, fzb antikoerper, wu:fk48e04 antikoerper, zg04 antikoerper, Xfz10A antikoerper, fzd10a antikoerper, Xfz10B antikoerper, Xfz9 antikoerper, fzd10b antikoerper, fzd9 antikoerper, frizzled class receptor 10 antikoerper, frizzled class receptor 10 L homeolog antikoerper, frizzled class receptor 10 S homeolog antikoerper, FZD10 antikoerper, fzd10 antikoerper, Fzd10 antikoerper, fzd10.L antikoerper, fzd10.S antikoerper
- Hintergrund
- FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- WNT Signalweg
-