ISLR2 Antikörper (N-Term)
-
- Target Alle ISLR2 Antikörper anzeigen
- ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ISLR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ISLR2 antibody was raised against the N terminal of ISLR2
- Aufreinigung
- Affinity purified
- Immunogen
- ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
- Top Product
- Discover our top product ISLR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISLR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))
- Andere Bezeichnung
- ISLR2 (ISLR2 Produkte)
- Hintergrund
- ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.
- Molekulargewicht
- 79 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-