Glycoprotein Antikörper

Produktnummer ABIN635807

Produktdetails

Target: Glycoprotein

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glycoprotein Blocking Peptide, catalog no. 33R-1913, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Glycoprotein

Synonyme: glycoprotein antikoerper, Glycoprotein antikoerper, transmembrane glycoprotein G antikoerper, G antikoerper, RVFV_sM_gp1 antikoerper, RABVgp4 antikoerper

Substanzklasse: Viral Protein

Hintergrund: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.

Molekulargewicht: 60 kDa (MW of target protein)