BTN1A1 Antikörper (N-Term)
-
- Target Alle BTN1A1 Antikörper anzeigen
- BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BTN1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BTN1 A1 antibody was raised against the N terminal of BTN1 1
- Aufreinigung
- Affinity purified
- Immunogen
- BTN1 A1 antibody was raised using the N terminal of BTN1 1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL
- Top Product
- Discover our top product BTN1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BTN1A1 Blocking Peptide, catalog no. 33R-5259, is also available for use as a blocking control in assays to test for specificity of this BTN1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))
- Andere Bezeichnung
- BTN1A1 (BTN1A1 Produkte)
- Hintergrund
- Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Activated T Cell Proliferation
-