GALNT5 Antikörper
-
- Target Alle GALNT5 Antikörper anzeigen
- GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALNT5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE
- Top Product
- Discover our top product GALNT5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALNT5 Blocking Peptide, catalog no. 33R-2573, is also available for use as a blocking control in assays to test for specificity of this GALNT5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))
- Andere Bezeichnung
- GALNT5 (GALNT5 Produkte)
- Hintergrund
- GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.
- Molekulargewicht
- 106 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-