B3GALT6 Antikörper (C-Term)
-
- Target Alle B3GALT6 Antikörper anzeigen
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B3GALT6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B3 GALT6 antibody was raised against the C terminal of B3 ALT6
- Aufreinigung
- Affinity purified
- Immunogen
- B3 GALT6 antibody was raised using the C terminal of B3 ALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE
- Top Product
- Discover our top product B3GALT6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B3GALT6 Blocking Peptide, catalog no. 33R-9759, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
- Andere Bezeichnung
- B3GALT6 (B3GALT6 Produkte)
- Synonyme
- B3GALT6 antikoerper, MGC69183 antikoerper, Dyak\\GE22868 antikoerper, GE22868 antikoerper, beta3galt6 antikoerper, dyak_GLEANR_663 antikoerper, Dere\\GG10628 antikoerper, GG10628 antikoerper, dere_GLEANR_10535 antikoerper, Dper\\GL21178 antikoerper, GL21178 antikoerper, dper_GLEANR_3106 antikoerper, Dsec\\GM20673 antikoerper, GM20673 antikoerper, dsec_GLEANR_3487 antikoerper, Dpse\\GA28758 antikoerper, GA28758 antikoerper, dpse_GLEANR_8882 antikoerper, EDSP2 antikoerper, SEMDJL1 antikoerper, beta3GalT6 antikoerper, BB129894 antikoerper, GalTII antikoerper, beta-1,3-galactosyltransferase 6 antikoerper, Beta-1,3-galactosyltransferase 6 antikoerper, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 antikoerper, UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6 antikoerper, B3GALT6 antikoerper, b3galt6 antikoerper, CpipJ_CPIJ010407 antikoerper, Dyak\beta3galt6 antikoerper, Dere\beta3galt6 antikoerper, Dper\beta3galt6 antikoerper, Dsec\beta3galt6 antikoerper, Dpse\beta3galt6 antikoerper, LOC100285906 antikoerper, B3galt6 antikoerper
- Hintergrund
- B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-