B3GALTL Antikörper (Middle Region)
-
- Target Alle B3GALTL Antikörper anzeigen
- B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B3GALTL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B3 GALTL antibody was raised against the middle region of B3 ALTL
- Aufreinigung
- Affinity purified
- Immunogen
- B3 GALTL antibody was raised using the middle region of B3 ALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE
- Top Product
- Discover our top product B3GALTL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B3GALTL Blocking Peptide, catalog no. 33R-2243, is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALTL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))
- Andere Bezeichnung
- B3GALTL (B3GALTL Produkte)
- Synonyme
- B3GLCT antikoerper, B3GTL antikoerper, B3Glc-T antikoerper, Gal-T antikoerper, beta3Glc-T antikoerper, Gm1057 antikoerper, beta 3-glucosyltransferase antikoerper, beta 3-glucosyltransferase L homeolog antikoerper, beta-3-glucosyltransferase antikoerper, B3GLCT antikoerper, b3glct antikoerper, b3glct.L antikoerper, B3glct antikoerper
- Hintergrund
- B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.
- Molekulargewicht
- 56 kDa (MW of target protein)
-