TIM3 Antikörper (N-Term)

Produktnummer ABIN635817

Produktdetails anti-TIM3 Antikörper

Target: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Bindungsspezifität: N-Term

Reaktivität: Hepatitis A Virus (HAV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAVCR2 antibody was raised against the N terminal of HAVCR2

Aufreinigung: Affinity purified

Immunogen: HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAVCR2 Blocking Peptide, catalog no. 33R-6002, is also available for use as a blocking control in assays to test for specificity of this HAVCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIM3

Target: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Andere Bezeichnung: HAVCR2 (TIM 3 Produkte)

Synonyme: HAVCR2 antikoerper, MGC140131 antikoerper, HAVcr-2 antikoerper, KIM-3 antikoerper, TIM3 antikoerper, TIMD-3 antikoerper, TIMD3 antikoerper, Tim-3 antikoerper, TIM-3 antikoerper, Tim3 antikoerper, Timd3 antikoerper, tim3 antikoerper, hepatitis A virus cellular receptor 2 antikoerper, HAVCR2 antikoerper, Havcr2 antikoerper

Substanzklasse: Virus

Hintergrund: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Cancer Immune Checkpoints