BRI3BP Antikörper (C-Term)

Produktnummer ABIN635825

Produktdetails anti-BRI3BP Antikörper

Target: BRI3BP (BRI3 Binding Protein (BRI3BP))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRI3BP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BRI3 BP antibody was raised against the C terminal of BRI3 P

Aufreinigung: Affinity purified

Immunogen: BRI3 BP antibody was raised using the C terminal of BRI3 P corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRI3BP Blocking Peptide, catalog no. 33R-3270, is also available for use as a blocking control in assays to test for specificity of this BRI3BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRI0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRI3BP

Target: BRI3BP (BRI3 Binding Protein (BRI3BP))

Andere Bezeichnung: BRI3BP (BRI3BP Produkte)

Synonyme: fa20c12 antikoerper, wu:fa20c12 antikoerper, kg19 antikoerper, bnas1 antikoerper, hccr-2 antikoerper, BNAS1 antikoerper, HCCR-1 antikoerper, HCCR-2 antikoerper, HCCRBP-1 antikoerper, KG19 antikoerper, 2410150I18Rik antikoerper, AI841257 antikoerper, AW742481 antikoerper, bri3 binding protein antikoerper, BRI3 binding protein pseudogene antikoerper, BRI3 binding protein L homeolog antikoerper, BRI3 binding protein antikoerper, Bri3 binding protein antikoerper, bri3bp antikoerper, LOC452360 antikoerper, bri3bp.L antikoerper, BRI3BP antikoerper, Bri3bp antikoerper

Hintergrund: BRI3BP is involved in the structural dynamics of the ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.

Molekulargewicht: 28 kDa (MW of target protein)