UGT1A4 Antikörper (N-Term)

Produktnummer ABIN635830

Produktdetails anti-UGT1A4 Antikörper

Target: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT1A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT1 A4 antibody was raised against the N terminal of µgT1 4

Aufreinigung: Affinity purified

Immunogen: UGT1 A4 antibody was raised using the N terminal of µgT1 4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT1A4 Blocking Peptide, catalog no. 33R-9886, is also available for use as a blocking control in assays to test for specificity of this µgT1A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT1A4

Target: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Andere Bezeichnung: UGT1A4 (UGT1A4 Produkte)

Synonyme: HUG-BR2 antikoerper, UDPGT antikoerper, UDPGT 1-4 antikoerper, UGT-1D antikoerper, UGT1-04 antikoerper, UGT1.4 antikoerper, UGT1D antikoerper, UGT1 antikoerper, UGT1A4 antikoerper, UDP glucuronosyltransferase family 1 member A4 antikoerper, UDP-glucuronosyltransferase 1-4 antikoerper, UGT1A4 antikoerper, UGT1-4 antikoerper

Hintergrund: UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha