SYVN1 Antikörper (C-Term)

Produktnummer ABIN635832

Produktdetails anti-SYVN1 Antikörper

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYVN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SYVN1 antibody was raised against the C terminal of SYVN1

Aufreinigung: Affinity purified

Immunogen: SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SYVN1 Blocking Peptide, catalog no. 33R-1484, is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYVN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYVN1

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Andere Bezeichnung: SYVN1 (SYVN1 Produkte)

Synonyme: DER3 antikoerper, HRD1 antikoerper, hrd1 antikoerper, 1200010C09Rik antikoerper, AW211966 antikoerper, C85322 antikoerper, D530017H19Rik antikoerper, Hrd1 antikoerper, RGD1310488 antikoerper, syvn1 antikoerper, syvn1-a antikoerper, syvn1-b antikoerper, wu:fk91f10 antikoerper, zgc:55735 antikoerper, zgc:77108 antikoerper, synoviolin 1 antikoerper, synovial apoptosis inhibitor 1, synoviolin antikoerper, synoviolin 1 S homeolog antikoerper, SYVN1 antikoerper, syvn1 antikoerper, Syvn1 antikoerper, syvn1.S antikoerper

Hintergrund: SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Negative Regulation of intrinsic apoptotic Signaling