IGF-like family receptor 1 (IGFLR1) (N-Term) Antikörper

Produktnummer ABIN635834

Produktdetails

Target: IGF-like family receptor 1 (IGFLR1)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM149 antibody was raised against the N terminal of TMEM149

Aufreinigung: Affinity purified

Immunogen: TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM149 Blocking Peptide, catalog no. 33R-9996, is also available for use as a blocking control in assays to test for specificity of this TMEM149 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM149 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: IGF-like family receptor 1 (IGFLR1)

Andere Bezeichnung: TMEM149 (IGFLR1 Produkte)

Hintergrund: TMEM149 is a single-pass type I membrane protein. The exact function of TMEM149 remains unknown.

Molekulargewicht: 38 kDa (MW of target protein)