UGT3A2 Antikörper (Middle Region)
-
- Target Alle UGT3A2 Antikörper anzeigen
- UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UGT3A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UGT3 A2 antibody was raised against the middle region of µgT3 2
- Aufreinigung
- Affinity purified
- Immunogen
- UGT3 A2 antibody was raised using the middle region of µgT3 2 corresponding to a region with amino acids RYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWH
- Top Product
- Discover our top product UGT3A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UGT3A2 Blocking Peptide, catalog no. 33R-8276, is also available for use as a blocking control in assays to test for specificity of this µgT3A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))
- Andere Bezeichnung
- UGT3A2 (UGT3A2 Produkte)
- Synonyme
- AI313915 antikoerper, UDPGT 3A1 antikoerper, ugt3a1 antikoerper, ugt3a2 antikoerper, UDP glycosyltransferase family 3 member A2 antikoerper, UDP glycosyltransferases 3 family, polypeptide A2 antikoerper, UDP glycosyltransferase 3 family, polypeptide A2 L homeolog antikoerper, UGT3A2 antikoerper, Ugt3a2 antikoerper, ugt3a2.L antikoerper
- Hintergrund
- UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
- Molekulargewicht
- 59 kDa (MW of target protein)
-