FZD7 Antikörper

Produktnummer ABIN635842

Produktdetails anti-FZD7 Antikörper

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD7 Blocking Peptide, catalog no. 33R-7010, is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD7

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Andere Bezeichnung: FZD7 (FZD7 Produkte)

Hintergrund: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: WNT Signalweg, Stem Cell Maintenance