TMEM158 Antikörper (Middle Region)
-
- Target Alle TMEM158 Antikörper anzeigen
- TMEM158 (Transmembrane Protein 158 (TMEM158))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM158 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM158 antibody was raised against the middle region of TMEM158
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
- Top Product
- Discover our top product TMEM158 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM158 (Transmembrane Protein 158 (TMEM158))
- Andere Bezeichnung
- TMEM158 (TMEM158 Produkte)
- Synonyme
- 2310037P21Rik antikoerper, Ris1 antikoerper, BBP antikoerper, RIS1 antikoerper, p40BBP antikoerper, transmembrane protein 158 antikoerper, transmembrane protein 158 (gene/pseudogene) antikoerper, Tmem158 antikoerper, TMEM158 antikoerper
- Hintergrund
- TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.
- Molekulargewicht
- 30 kDa (MW of target protein)
-