BACE1 Antikörper (N-Term)
-
- Target Alle BACE1 Antikörper anzeigen
- BACE1 (Beta-secretase 1 (BACE1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BACE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BACE1 antibody was raised against the N terminal of BACE1
- Aufreinigung
- Affinity purified
- Immunogen
- BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
- Top Product
- Discover our top product BACE1 Primärantikörper
-
anti-Beta-secretase 1 (BACE1) (AA 112-324) antibody
BACE1 Reaktivität: Human WB, ELISA, ICC, FACS Wirt: Maus Monoclonal 3C1C3 unconjugated
anti-Beta-secretase 1 (BACE1) (AA 22-501) antibodyBACE1 Reaktivität: Human WB, ELISA, IHC (p), PLA Wirt: Maus Monoclonal 2C1 unconjugated
anti-Beta-secretase 1 (BACE1) (N-Term) antibodyBACE1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 401-501) antibodyBACE1 Reaktivität: Human, Maus, Ratte WB, ELISA, ICC, IHC (p), FACS, IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 38-70), (N-Term) antibodyBACE1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB16874 unconjugated
anti-Beta-secretase 1 (BACE1) (AA 22-322) antibodyBACE1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 46-155) antibodyBACE1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (C-Term) antibodyBACE1 Reaktivität: Human, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 72-121) antibodyBACE1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Affe, Schwein, Fledermaus, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 170-428) antibodyBACE1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BACE1 (Beta-secretase 1 (BACE1))
- Andere Bezeichnung
- BACE1 (BACE1 Produkte)
- Synonyme
- ASP2 antikoerper, BACE antikoerper, HSPC104 antikoerper, C76936 antikoerper, Bace antikoerper, MGC145931 antikoerper, BACE1 antikoerper, zgc:77409 antikoerper, beta-secretase 1 antikoerper, beta-site APP cleaving enzyme 1 antikoerper, beta-site APP-cleaving enzyme 1 antikoerper, BACE1 antikoerper, Bace1 antikoerper, bace1 antikoerper
- Hintergrund
- Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.
- Molekulargewicht
- 51 kDa (MW of target protein)
-
