ST6GALNAC4 Antikörper (Middle Region)

Produktnummer ABIN635850

Produktdetails anti-ST6GALNAC4 Antikörper

Target: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST6GALNAC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST6 GALNAC4 antibody was raised against the middle region of ST6 ALNAC4

Aufreinigung: Affinity purified

Immunogen: ST6 GALNAC4 antibody was raised using the middle region of ST6 ALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST6GALNAC4 Blocking Peptide, catalog no. 33R-7650, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST6GALNAC4

Target: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Andere Bezeichnung: ST6GALNAC4 (ST6GALNAC4 Produkte)

Synonyme: ST6GALNAC-IV antikoerper, IV antikoerper, SIAT3-C antikoerper, SIAT3C antikoerper, SIAT7-D antikoerper, SIAT7D antikoerper, ST6GALNACIV antikoerper, ST6GalNAc antikoerper, SIAT7B antikoerper, ST6GALNAC2 antikoerper, st6GalNAc-IV antikoerper, ST6GalNAcIV antikoerper, Siat7d antikoerper, siat7D antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 antikoerper, ST6GALNAC4 antikoerper, St6galnac4 antikoerper

Hintergrund: ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.

Molekulargewicht: 34 kDa (MW of target protein)