TEX264 Antikörper (Middle Region)

Produktnummer ABIN635856

Produktdetails anti-TEX264 Antikörper

Target: TEX264 (Testis Expressed 264 (TEX264))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TEX264 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TEX264 antibody was raised against the middle region of TEX264

Aufreinigung: Affinity purified

Immunogen: TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TEX264 Blocking Peptide, catalog no. 33R-3666, is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX264 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TEX264

Target: TEX264 (Testis Expressed 264 (TEX264))

Andere Bezeichnung: TEX264 (TEX264 Produkte)

Synonyme: ZSIG11 antikoerper, TEG-264 antikoerper, testis expressed 264 antikoerper, testis expressed gene 264 antikoerper, TEX264 antikoerper, Tex264 antikoerper

Hintergrund: The specific function of TEX264 is not yet known.

Molekulargewicht: 34 kDa (MW of target protein)