SLITRK6 Antikörper (N-Term)

Produktnummer ABIN635857

Produktdetails anti-SLITRK6 Antikörper

Target: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLITRK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLITRK6 antibody was raised against the N terminal of SLITRK6

Aufreinigung: Affinity purified

Immunogen: SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLITRK6

Target: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Andere Bezeichnung: SLITRK6 (SLITRK6 Produkte)

Synonyme: 4832410J21Rik antikoerper, Sltk6 antikoerper, SLIT and NTRK like family member 6 antikoerper, SLIT and NTRK-like family, member 6 antikoerper, SLITRK6 antikoerper, slitrk6 antikoerper, Slitrk6 antikoerper

Hintergrund: Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Molekulargewicht: 95 kDa (MW of target protein)