SLITRK6 Antikörper (N-Term)
-
- Target Alle SLITRK6 Antikörper anzeigen
- SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLITRK6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLITRK6 antibody was raised against the N terminal of SLITRK6
- Aufreinigung
- Affinity purified
- Immunogen
- SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL
- Top Product
- Discover our top product SLITRK6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))
- Andere Bezeichnung
- SLITRK6 (SLITRK6 Produkte)
- Hintergrund
- Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.
- Molekulargewicht
- 95 kDa (MW of target protein)
-