Neuropilin 1 Antikörper (N-Term)
-
- Target Alle Neuropilin 1 (NRP1) Antikörper anzeigen
- Neuropilin 1 (NRP1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Neuropilin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Neuropilin antibody was raised against the N terminal of NETO2
- Aufreinigung
- Affinity purified
- Immunogen
- Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE
- Top Product
- Discover our top product NRP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Neuropilin Blocking Peptide, catalog no. 33R-3329, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Neuropilin 1 (NRP1)
- Andere Bezeichnung
- Neuropilin (NRP1 Produkte)
- Synonyme
- NRP1 antikoerper, cd304 antikoerper, neuropilin antikoerper, np-1 antikoerper, npn-1 antikoerper, nrp antikoerper, nrp-1 antikoerper, vegf165r antikoerper, BDCA4 antikoerper, CD304 antikoerper, NP1 antikoerper, NRP antikoerper, VEGF165R antikoerper, C530029I03 antikoerper, NP-1 antikoerper, NPN-1 antikoerper, Npn1 antikoerper, Nrp antikoerper, neuropilin 1 antikoerper, neuropilin 1 L homeolog antikoerper, NRP1 antikoerper, nrp1 antikoerper, Nrp1 antikoerper, nrp1.L antikoerper
- Hintergrund
- NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals
-