UGT1A1 Antikörper (N-Term)
-
- Target Alle UGT1A1 Antikörper anzeigen
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UGT1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UGT1 A1 antibody was raised against the N terminal of µgT1 1
- Aufreinigung
- Affinity purified
- Immunogen
- UGT1 A1 antibody was raised using the N terminal of µgT1 1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
- Top Product
- Discover our top product UGT1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UGT1A1 Blocking Peptide, catalog no. 33R-1966, is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
- Andere Bezeichnung
- UGT1A1 (UGT1A1 Produkte)
- Synonyme
- BILIQTL1 antikoerper, GNT1 antikoerper, HUG-BR1 antikoerper, UDPGT antikoerper, UDPGT 1-1 antikoerper, UGT1 antikoerper, UGT1A antikoerper, Gnt1 antikoerper, UGT1A01 antikoerper, Udpgt-1a antikoerper, UgtBr1 antikoerper, Udpgt antikoerper, Ugt1 antikoerper, zgc:123097 antikoerper, UDP glucuronosyltransferase family 1 member A1 antikoerper, UDP glucuronosyltransferase 1 family, polypeptide A1 antikoerper, UDP-glucuronosyltransferase 1-1 antikoerper, UDP-glucuronosyltransferase antikoerper, UDP-glucuronosyltransferase 1-6 antikoerper, UDP glucuronosyltransferase 1 family polypeptide a1 antikoerper, UGT1A1 antikoerper, Ugt1a1 antikoerper, LOC100065342 antikoerper, LOC100125517 antikoerper, LOC100229734 antikoerper, LOC100405984 antikoerper, LOC100511479 antikoerper, ugt1a1 antikoerper
- Hintergrund
- UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-