GPAA1 Antikörper
-
- Target Alle GPAA1 Antikörper anzeigen
- GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPAA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
- Top Product
- Discover our top product GPAA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPAA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))
- Andere Bezeichnung
- GPAA1 (GPAA1 Produkte)
- Synonyme
- GAA1 antikoerper, hGAA1 antikoerper, C80044 antikoerper, mGAA1 antikoerper, glycosylphosphatidylinositol anchor attachment 1 antikoerper, GPI anchor attachment protein 1 antikoerper, GPAA1 antikoerper, Gpaa1 antikoerper
- Hintergrund
- Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom
-