AOC2 Antikörper

Produktnummer ABIN635871

Produktdetails anti-AOC2 Antikörper

Target: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AOC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AOC2 Blocking Peptide (retina specific), catalog no. 33R-7481, is also available for use as a blocking control in assays to test for specificity of this AOC2 antibody (retina specific)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AOC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AOC2

Target: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Andere Bezeichnung: AOC2 (AOC2 Produkte)

Hintergrund: Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.

Molekulargewicht: 84 kDa (MW of target protein)