LMF1 Antikörper (N-Term)
-
- Target Alle LMF1 Antikörper anzeigen
- LMF1 (Lipase Maturation Factor 1 (LMF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LMF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LMF1 antibody was raised against the N terminal of LMF1
- Aufreinigung
- Affinity purified
- Immunogen
- LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW
- Top Product
- Discover our top product LMF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LMF1 (Lipase Maturation Factor 1 (LMF1))
- Andere Bezeichnung
- LMF1 (LMF1 Produkte)
- Hintergrund
- The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.
- Molekulargewicht
- 65 kDa (MW of target protein)
-