IGLL1 Antikörper (N-Term)
-
- Target Alle IGLL1 Antikörper anzeigen
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGLL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIGO antibody was raised against the N terminal of PIGO
- Aufreinigung
- Affinity purified
- Immunogen
- PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
- Top Product
- Discover our top product IGLL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
- Andere Bezeichnung
- IGO (IGLL1 Produkte)
- Synonyme
- 14.1 antikoerper, AGM2 antikoerper, CD179b antikoerper, IGL1 antikoerper, IGL5 antikoerper, IGLJ14.1 antikoerper, IGLL antikoerper, IGO antikoerper, IGVPB antikoerper, VPREB2 antikoerper, IGLV antikoerper, IGLL1 antikoerper, MGC151892 antikoerper, Igll1 antikoerper, BB139905 antikoerper, Igl-5 antikoerper, Igll antikoerper, Lambda5 antikoerper, immunoglobulin lambda like polypeptide 1 antikoerper, immunoglobulin lambda-like polypeptide 1 antikoerper, IGLL1 antikoerper, Igll1 antikoerper
- Hintergrund
- PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.
- Molekulargewicht
- 74 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-