HHAT Antikörper (N-Term)

Produktnummer ABIN635877

Produktdetails anti-HHAT Antikörper

Target: HHAT (Hedgehog Acyltransferase (HHAT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HHAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HHAT antibody was raised against the N terminal of HHAT

Aufreinigung: Affinity purified

Immunogen: HHAT antibody was raised using the N terminal of HHAT corresponding to a region with amino acids MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HHAT Blocking Peptide, catalog no. 33R-6202, is also available for use as a blocking control in assays to test for specificity of this HHAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HHAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HHAT

Target: HHAT (Hedgehog Acyltransferase (HHAT))

Andere Bezeichnung: HHAT (HHAT Produkte)

Synonyme: RGD1311746 antikoerper, MART2 antikoerper, SKI1 antikoerper, Skn antikoerper, 2810432O22Rik antikoerper, AI462858 antikoerper, AP-2CRE antikoerper, Tg(TFAP2A-cre)1Will antikoerper, hedgehog acyltransferase antikoerper, Hhat antikoerper, HHAT antikoerper, hhat antikoerper

Hintergrund: Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog'.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Hedgehog Signalweg