FZD6 Antikörper

Produktnummer ABIN635881

Produktdetails anti-FZD6 Antikörper

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD6

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Andere Bezeichnung: FZD6 (FZD6 Produkte)

Synonyme: zgc:65879 antikoerper, zgc:77440 antikoerper, fz6 antikoerper, frz6 antikoerper, Xfrz6 antikoerper, frizzled6 antikoerper, frizzled-6 antikoerper, FZ-6 antikoerper, FZ6 antikoerper, HFZ6 antikoerper, NDNC10 antikoerper, Frizzled-6 antikoerper, Fz6 antikoerper, frizzled class receptor 6 antikoerper, frizzled class receptor 6 S homeolog antikoerper, fzd6 antikoerper, fzd6.S antikoerper, FZD6 antikoerper, Fzd6 antikoerper

Hintergrund: This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Molekulargewicht: 79 kDa (MW of target protein)

Pathways: WNT Signalweg, Tube Formation