LMAN2 Antikörper (N-Term)
-
- Target Alle LMAN2 Antikörper anzeigen
- LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LMAN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- LMAN2 antibody was raised against the N terminal of LMAN2
- Aufreinigung
- Affinity purified
- Immunogen
- LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LMAN2 Blocking Peptide, catalog no. 33R-8595, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))
- Andere Bezeichnung
- LMAN2 (LMAN2 Produkte)
- Synonyme
- Lman2 antikoerper, wu:fb16f04 antikoerper, zgc:158761 antikoerper, C5orf8 antikoerper, GP36B antikoerper, VIP36 antikoerper, 1110003H06Rik antikoerper, 1300009F09Rik antikoerper, AA408240 antikoerper, AL023023 antikoerper, AU040819 antikoerper, Vip36 antikoerper, lectin, mannose binding 2 antikoerper, lectin, mannose-binding 2 antikoerper, LMAN2 antikoerper, lman2 antikoerper, Lman2 antikoerper
- Hintergrund
- LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-