AMIGO3 Antikörper (N-Term)

Produktnummer ABIN635891

Produktdetails anti-AMIGO3 Antikörper

Target: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMIGO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AMIGO3 antibody was raised against the N terminal of AMIGO3

Aufreinigung: Affinity purified

Immunogen: AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMIGO3 Blocking Peptide, catalog no. 33R-6574, is also available for use as a blocking control in assays to test for specificity of this AMIGO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMIGO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMIGO3

Target: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Andere Bezeichnung: AMIGO3 (AMIGO3 Produkte)

Synonyme: E430002N15Rik antikoerper, ali3 antikoerper, mKIAA1851 antikoerper, AMIGO-3 antikoerper, adhesion molecule with Ig-like domain 3 antikoerper, adhesion molecule with Ig like domain 3 antikoerper, amigo3 antikoerper, Amigo3 antikoerper, AMIGO3 antikoerper

Hintergrund: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Molekulargewicht: 55 kDa (MW of target protein)