NDST3 Antikörper

Produktnummer ABIN635893

Produktdetails anti-NDST3 Antikörper

Target: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDST3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDST3 Blocking Peptide, catalog no. 33R-7135, is also available for use as a blocking control in assays to test for specificity of this NDST3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDST3

Target: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Andere Bezeichnung: NDST3 (NDST3 Produkte)

Synonyme: NDST3 antikoerper, HSST3 antikoerper, 4921531K01Rik antikoerper, 4930511P15Rik antikoerper, N-deacetylase and N-sulfotransferase 3 antikoerper, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 antikoerper, NDST3 antikoerper, ndst3 antikoerper, LOC100484094 antikoerper, LOC100539813 antikoerper, Ndst3 antikoerper

Hintergrund: NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin.

Molekulargewicht: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process