SPINT2 Antikörper (Middle Region)
-
- Target Alle SPINT2 Antikörper anzeigen
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPINT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SPINT2 antibody was raised against the middle region of SPINT2
- Aufreinigung
- Affinity purified
- Immunogen
- SPINT2 antibody was raised using the middle region of SPINT2 corresponding to a region with amino acids MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE
- Top Product
- Discover our top product SPINT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPINT2 Blocking Peptide, catalog no. 33R-6208, is also available for use as a blocking control in assays to test for specificity of this SPINT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
- Andere Bezeichnung
- SPINT2 (SPINT2 Produkte)
- Synonyme
- HAI-2 antikoerper, Pb antikoerper, DIAR3 antikoerper, HAI2 antikoerper, Kop antikoerper, PB antikoerper, AL024025 antikoerper, C76321 antikoerper, serine peptidase inhibitor, Kunitz type, 2 antikoerper, serine peptidase inhibitor, Kunitz type 2 antikoerper, serine protease inhibitor, Kunitz type 2 antikoerper, Spint2 antikoerper, SPINT2 antikoerper
- Hintergrund
- HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the kDa-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
- Molekulargewicht
- 28 kDa (MW of target protein)
-