RMDN3 Antikörper (Middle Region)

Produktnummer ABIN635897

Produktdetails anti-RMDN3 Antikörper

Target: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RMDN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM82 C antibody was raised against the middle region of Fam82

Aufreinigung: Affinity purified

Immunogen: FAM82 C antibody was raised using the middle region of Fam82 corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM82C Blocking Peptide, catalog no. 33R-5411, is also available for use as a blocking control in assays to test for specificity of this FAM82C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RMDN3

Target: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Andere Bezeichnung: FAM82C (FAM82A2 Produkte)

Synonyme: FAM82A2 antikoerper, FAM82C antikoerper, RMD-3 antikoerper, RMD3 antikoerper, ptpip51 antikoerper, Fam82a2 antikoerper, Fam82c antikoerper, Ptpip51 antikoerper, RGD1308697 antikoerper, Rmd-3 antikoerper, 1200015F23Rik antikoerper, AI131757 antikoerper, Rmd3 antikoerper, fam82a2 antikoerper, fam82c antikoerper, regulator of microtubule dynamics 3 antikoerper, regulator of microtubule dynamics 3 L homeolog antikoerper, RMDN3 antikoerper, Rmdn3 antikoerper, rmdn3.L antikoerper

Hintergrund: FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.

Molekulargewicht: 52 kDa (MW of target protein)