C2CD2L Antikörper (C-Term)

Produktnummer ABIN635898

Produktdetails anti-C2CD2L Antikörper

Target: C2CD2L (C2CD2-Like (C2CD2L))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C2CD2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM24 antibody was raised against the C terminal Of Tmem24

Aufreinigung: Affinity purified

Immunogen: TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM24 Blocking Peptide, catalog no. 33R-1209, is also available for use as a blocking control in assays to test for specificity of this TMEM24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C2CD2L

Target: C2CD2L (C2CD2-Like (C2CD2L))

Andere Bezeichnung: TMEM24 (C2CD2L Produkte)

Synonyme: TMEM24 antikoerper, 1300006O23Rik antikoerper, Tmem24 antikoerper, tmem24 antikoerper, zgc:153961 antikoerper, C2CD2 like antikoerper, C2 calcium-dependent domain containing 2-like antikoerper, C2CD2-like antikoerper, c2cd2-like antikoerper, C2CD2L antikoerper, C2cd2l antikoerper, c2cd2l antikoerper

Hintergrund: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Molekulargewicht: 76 kDa (MW of target protein)