CLPTM1L Antikörper (Middle Region)

Produktnummer ABIN635900

Produktdetails anti-CLPTM1L Antikörper

Target: CLPTM1L (CLPTM1-Like (CLPTM1L))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLPTM1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLPTM1 L antibody was raised against the middle region of CLPTM1

Aufreinigung: Affinity purified

Immunogen: CLPTM1 L antibody was raised using the middle region of CLPTM1 corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLPTM1L Blocking Peptide, catalog no. 33R-4238, is also available for use as a blocking control in assays to test for specificity of this CLPTM1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPTM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLPTM1L

Target: CLPTM1L (CLPTM1-Like (CLPTM1L))

Andere Bezeichnung: CLPTM1L (CLPTM1L Produkte)

Synonyme: CRR9 antikoerper, C130052I12Rik antikoerper, Crr9 antikoerper, RGD1307896 antikoerper, C130052I12RIK antikoerper, CLPTM1 like antikoerper, CLPTM1-like antikoerper, cleft lip and palate transmembrane protein 1-like protein antikoerper, CLPTM1L antikoerper, clptm1l antikoerper, LOC100338302 antikoerper, Clptm1l antikoerper

Hintergrund: CLPTM1L enhances cisplatin-mediated apoptosis, when overexpressed.

Molekulargewicht: 62 kDa (MW of target protein)