TMEM123 Antikörper (C-Term)

Produktnummer ABIN635901

Produktdetails anti-TMEM123 Antikörper

Target: TMEM123 (Transmembrane Protein 123 (TMEM123))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM123 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM123 antibody was raised against the C terminal of TMEM123

Aufreinigung: Affinity purified

Immunogen: TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM123 Blocking Peptide, catalog no. 33R-8860, is also available for use as a blocking control in assays to test for specificity of this TMEM123 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM123 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM123

Target: TMEM123 (Transmembrane Protein 123 (TMEM123))

Andere Bezeichnung: TMEM123 (TMEM123 Produkte)

Synonyme: KCT3 antikoerper, PORIMIN antikoerper, PORMIN antikoerper, 2310075C12Rik antikoerper, RGD1305625 antikoerper, kct3 antikoerper, pormin antikoerper, porimin antikoerper, transmembrane protein 123 antikoerper, transmembrane protein 123 L homeolog antikoerper, TMEM123 antikoerper, Tmem123 antikoerper, tmem123.L antikoerper, tmem123 antikoerper

Hintergrund: TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size