PQLC1 Antikörper (Middle Region)
-
- Target Alle PQLC1 Antikörper anzeigen
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PQLC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PQLC1 antibody was raised against the middle region of PQLC1
- Aufreinigung
- Affinity purified
- Immunogen
- PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW
- Top Product
- Discover our top product PQLC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PQLC1 Blocking Peptide, catalog no. 33R-9395, is also available for use as a blocking control in assays to test for specificity of this PQLC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PQLC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
- Andere Bezeichnung
- PQLC1 (PQLC1 Produkte)
- Synonyme
- 2310009N05Rik antikoerper, 4933425L21Rik antikoerper, 5730564E11Rik antikoerper, C78974 antikoerper, pqlc1 antikoerper, PQ loop repeat containing 1 antikoerper, PQ loop repeat containing 1, gene 1 L homeolog antikoerper, PQLC1 antikoerper, Pqlc1 antikoerper, pqlc1.1.L antikoerper
- Hintergrund
- PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.
- Molekulargewicht
- 30 kDa (MW of target protein)
-