RNF133 Antikörper (N-Term)

Produktnummer ABIN635910

Produktdetails anti-RNF133 Antikörper

Target: RNF133 (Ring Finger Protein 133 (RNF133))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF133 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF133 antibody was raised against the N terminal of RNF133

Aufreinigung: Affinity purified

Immunogen: RNF133 antibody was raised using the N terminal of RNF133 corresponding to a region with amino acids VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF133 Blocking Peptide, catalog no. 33R-9908, is also available for use as a blocking control in assays to test for specificity of this RNF133 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF133 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF133

Target: RNF133 (Ring Finger Protein 133 (RNF133))

Andere Bezeichnung: RNF133 (RNF133 Produkte)

Synonyme: Greul2 antikoerper, ring finger protein 133 antikoerper, RNF133 antikoerper, Rnf133 antikoerper

Hintergrund: RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molekulargewicht: 42 kDa (MW of target protein)