MTTP Antikörper (N-Term)

Produktnummer ABIN635912

Produktdetails anti-MTTP Antikörper

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTTP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTTP antibody was raised against the N terminal of MTTP

Aufreinigung: Affinity purified

Immunogen: MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTTP Blocking Peptide, catalog no. 33R-6112, is also available for use as a blocking control in assays to test for specificity of this MTTP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTTP

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Andere Bezeichnung: MTTP (MTTP Produkte)

Synonyme: ABL antikoerper, MTP antikoerper, 1810043K16Rik antikoerper, CG9342 antikoerper, CT3751 antikoerper, Dmel\\CG9342 antikoerper, dMTP antikoerper, wu:fd36b01 antikoerper, zgc:111876 antikoerper, microsomal triglyceride transfer protein antikoerper, Microsomal triacylglycerol transfer protein antikoerper, MTTP antikoerper, Mttp antikoerper, Mtp antikoerper, mttp antikoerper

Hintergrund: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis