MTTP Antikörper (N-Term)
-
- Target Alle MTTP Antikörper anzeigen
- MTTP (Microsomal Triglyceride Transfer Protein (MTTP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTTP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTTP antibody was raised against the N terminal of MTTP
- Aufreinigung
- Affinity purified
- Immunogen
- MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
- Top Product
- Discover our top product MTTP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTTP Blocking Peptide, catalog no. 33R-6112, is also available for use as a blocking control in assays to test for specificity of this MTTP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTTP (Microsomal Triglyceride Transfer Protein (MTTP))
- Andere Bezeichnung
- MTTP (MTTP Produkte)
- Hintergrund
- MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
- Molekulargewicht
- 97 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-