ACP2 Antikörper (Middle Region)
-
- Target Alle ACP2 Antikörper anzeigen
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACP2 antibody was raised against the middle region of ACP2
- Aufreinigung
- Affinity purified
- Immunogen
- ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET
- Top Product
- Discover our top product ACP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
- Andere Bezeichnung
- ACP2 (ACP2 Produkte)
- Synonyme
- ACP2 antikoerper, Acp-2 antikoerper, LAP antikoerper, acid phosphatase 2, lysosomal antikoerper, acid phosphatase 2, lysosomal S homeolog antikoerper, ACP2 antikoerper, acp2 antikoerper, Acp2 antikoerper, acp2.S antikoerper
- Hintergrund
- ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.
- Molekulargewicht
- 45 kDa (MW of target protein)
-