ALG1 Antikörper (N-Term)
-
- Target Alle ALG1 Antikörper anzeigen
- ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALG1 antibody was raised against the N terminal of ALG1
- Aufreinigung
- Affinity purified
- Immunogen
- ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG
- Top Product
- Discover our top product ALG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))
- Andere Bezeichnung
- ALG1 (ALG1 Produkte)
- Hintergrund
- ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).
- Molekulargewicht
- 52 kDa (MW of target protein)
-