ALG1 Antikörper (N-Term)

Produktnummer ABIN635919

Produktdetails anti-ALG1 Antikörper

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALG1 antibody was raised against the N terminal of ALG1

Aufreinigung: Affinity purified

Immunogen: ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG1

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Andere Bezeichnung: ALG1 (ALG1 Produkte)

Synonyme: CDG1K antikoerper, HMAT1 antikoerper, HMT-1 antikoerper, HMT1 antikoerper, MT-1 antikoerper, Mat-1 antikoerper, hMat-1 antikoerper, zgc:66221 antikoerper, wu:fi34b12 antikoerper, alg1 antikoerper, hmat1 antikoerper, hmt1 antikoerper, ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase antikoerper, asparagine-linked glycosylation 1 (beta-1,4-mannosyltransferase) antikoerper, Beta-mannosyltransferase antikoerper, ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase L homeolog antikoerper, ALG1 antikoerper, Alg1 antikoerper, alg1 antikoerper, alg1.L antikoerper

Hintergrund: ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).

Molekulargewicht: 52 kDa (MW of target protein)