SLC8A3 Antikörper
-
- Target Alle SLC8A3 Antikörper anzeigen
- SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC8A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC8 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
- Top Product
- Discover our top product SLC8A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC8A3 Blocking Peptide, catalog no. 33R-8309, is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))
- Andere Bezeichnung
- SLC8A3 (SLC8A3 Produkte)
- Hintergrund
- SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.
- Molekulargewicht
- 103 kDa (MW of target protein)
-