SLC8A3 Antikörper

Produktnummer ABIN635923

Produktdetails anti-SLC8A3 Antikörper

Target: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC8A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC8 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC8A3 Blocking Peptide, catalog no. 33R-8309, is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC8A3

Target: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Andere Bezeichnung: SLC8A3 (SLC8A3 Produkte)

Synonyme: SLC8A3 antikoerper, NCX3 antikoerper, Ncx3 antikoerper, AW742262 antikoerper, solute carrier family 8 member A3 antikoerper, solute carrier family 8 (sodium/calcium exchanger), member 3 antikoerper, SLC8A3 antikoerper, slc8a3 antikoerper, Slc8a3 antikoerper

Hintergrund: SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.

Molekulargewicht: 103 kDa (MW of target protein)