DNAJB11 Antikörper
-
- Target Alle DNAJB11 Antikörper anzeigen
- DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJB11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
- Top Product
- Discover our top product DNAJB11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJB11 Blocking Peptide, catalog no. 33R-2868, is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))
- Andere Bezeichnung
- DNAJB11 (DNAJB11 Produkte)
- Hintergrund
- DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-