DNAJB11 Antikörper

Produktnummer ABIN635926

Produktdetails anti-DNAJB11 Antikörper

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJB11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJB11 Blocking Peptide, catalog no. 33R-2868, is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJB11

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Andere Bezeichnung: DNAJB11 (DNAJB11 Produkte)

Synonyme: MGC75796 antikoerper, MGC81924 antikoerper, ABBP-2 antikoerper, ABBP2 antikoerper, DJ9 antikoerper, Dj-9 antikoerper, EDJ antikoerper, ERdj3 antikoerper, ERj3 antikoerper, ERj3p antikoerper, PRO1080 antikoerper, UNQ537 antikoerper, hDj-9 antikoerper, 1810031F23Rik antikoerper, AL024055 antikoerper, Dj9 antikoerper, LRRGT00084 antikoerper, cb954 antikoerper, DnaJ heat shock protein family (Hsp40) member B11 antikoerper, DnaJ heat shock protein family (Hsp40) member B11 S homeolog antikoerper, DnaJ (Hsp40) homolog, subfamily B, member 11 antikoerper, dnajb11 antikoerper, DNAJB11 antikoerper, dnajb11.S antikoerper, Dnajb11 antikoerper

Hintergrund: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling