C12orf49 Antikörper (C-Term)

Produktnummer ABIN635928

Produktdetails anti-C12orf49 Antikörper

Target: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C12orf49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C12 ORF49 antibody was raised against the C terminal Of C12 rf49

Aufreinigung: Affinity purified

Immunogen: C12 ORF49 antibody was raised using the C terminal Of C12 rf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C12ORF49 Blocking Peptide, catalog no. 33R-4924, is also available for use as a blocking control in assays to test for specificity of this C12ORF49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C12orf49

Target: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Andere Bezeichnung: C12ORF49 (C12orf49 Produkte)

Synonyme: C12orf49 antikoerper, chromosome 12 open reading frame 49 antikoerper, chromosome 17 open reading frame, human C12orf49 antikoerper, chromosome 15 C12orf49 homolog antikoerper, chromosome 12 open reading frame 49 S homeolog antikoerper, RIKEN cDNA 2410131K14 gene antikoerper, zgc:110063 antikoerper, C12orf49 antikoerper, C17H12orf49 antikoerper, C15H12orf49 antikoerper, c12orf49.S antikoerper, c12orf49 antikoerper, 2410131K14Rik antikoerper, zgc:110063 antikoerper

Hintergrund: The function of C12orf49 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 23 kDa (MW of target protein)