ERMAP Antikörper
-
- Target Alle ERMAP Antikörper anzeigen
- ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERMAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN
- Top Product
- Discover our top product ERMAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERMAP Blocking Peptide, catalog no. 33R-6968, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERMAP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))
- Andere Bezeichnung
- ERMAP (ERMAP Produkte)
- Hintergrund
- The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.
- Molekulargewicht
- 52 kDa (MW of target protein)
-