ERMAP Antikörper

Produktnummer ABIN635933

Produktdetails anti-ERMAP Antikörper

Target: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERMAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERMAP Blocking Peptide, catalog no. 33R-6968, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERMAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERMAP

Target: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Andere Bezeichnung: ERMAP (ERMAP Produkte)

Synonyme: AA409279 antikoerper, AI666418 antikoerper, PRO2801 antikoerper, RD antikoerper, SC antikoerper, erythroblast membrane associated protein (Scianna blood group) antikoerper, erythroblast membrane-associated protein antikoerper, ERMAP antikoerper, Ermap antikoerper

Hintergrund: The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 52 kDa (MW of target protein)