SLC5A8 Antikörper
-
- Target Alle SLC5A8 Antikörper anzeigen
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC5A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC5 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
- Top Product
- Discover our top product SLC5A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC5A8 Blocking Peptide, catalog no. 33R-3337, is also available for use as a blocking control in assays to test for specificity of this SLC5A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
- Andere Bezeichnung
- SLC5A8 (SLC5A8 Produkte)
- Synonyme
- Ait antikoerper, SMCT antikoerper, SMCT1 antikoerper, AIT antikoerper, RGD1564146 antikoerper, solute carrier family 5 (iodide transporter), member 8 antikoerper, solute carrier family 5 member 8 antikoerper, Slc5a8 antikoerper, SLC5A8 antikoerper
- Hintergrund
- SLC5A8 has been shown to transport iodide by a passive mechanism and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism.
- Molekulargewicht
- 66 kDa (MW of target protein)
-